PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G176700.1.p
Common NameGLYMA_04G176700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 267aa    MW: 30195.2 Da    PI: 9.7502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G176700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.4e-111359147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         rg WTteEd + +    ++ +g+W++++++  ++R++k+c++rw +y
  Glyma.04G176700.1.p 13 RGVWTTEEDTKKLAFGSKHRSGNWTSVPKKSRLKRCGKSCRLRWTNY 59
                         899******************************************99 PP

2Myb_DNA-binding30.21e-0968108346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          ++Tt+Ed l+ ++++  G++ W+ +a+ +  gRt++++k++w++
  Glyma.04G176700.1.p  68 NFTTQED-LIMKLHAAIGSR-WSIVAQQLL-GRTDNDVKNYWNT 108
                          5677766.789*********.********9.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-15563IPR009057Homeodomain-like
PROSITE profilePS5129410.62860IPR017930Myb domain
SuperFamilySSF466891.52E-2010106IPR009057Homeodomain-like
SMARTSM007177.2E-61262IPR001005SANT/Myb domain
PfamPF002491.5E-91359IPR001005SANT/Myb domain
CDDcd001673.29E-51659No hitNo description
PROSITE profilePS5129416.16261114IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-1864114IPR009057Homeodomain-like
SMARTSM007173.4E-665112IPR001005SANT/Myb domain
CDDcd001671.76E-568110No hitNo description
PfamPF002493.0E-870108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MVRYPCEKIN VKRGVWTTEE DTKKLAFGSK HRSGNWTSVP KKSRLKRCGK SCRLRWTNYP  60
RPDLKDDNFT TQEDLIMKLH AAIGSRWSIV AQQLLGRTDN DVKNYWNTKL KKKLSQMGID  120
PVTHKPFSKL ISDYGNIGDC QKPSTPITST NKDFKDAMML GSDPRQTLPQ GFTNINDQPK  180
LSPKTIPVSM FGEDCLSKTS SPSTPSTCFT SSAFSWNDFL LEDAFIPFTN QEQRLEAKSL  240
QASSSDFHFS SSRDISFIKA MLDQEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21131147108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014630751.11e-176PREDICTED: transcription factor MYB35-like
SwissprotQ9XHV09e-57MYB80_ARATH; Transcription factor MYB80
TrEMBLK7KKT30.0K7KKT3_SOYBN; Uncharacterized protein
STRINGGLYMA04G34631.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-57myb domain protein 103